PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf15421g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 228aa    MW: 26021 Da    PI: 9.4116
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf15421g00001.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF60.52e-191858141
                              S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE- CS
                    SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifs 41
                              k+i+n+  r+vtfskRr g++KKA+EL++L++ae+ +i+ s
  Peinf101Scf15421g00001.1 18 KPIDNQNSRHVTFSKRRLGLFKKASELCILTGAEIVIIVQS 58
                              68************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006620.3811058IPR002100Transcription factor, MADS-box
SMARTSM004328.7E-231070IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.37E-221197IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-111232IPR002100Transcription factor, MADS-box
PfamPF003191.3E-182067IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-113247IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MNVNTLKKTQ GRRKIAIKPI DNQNSRHVTF SKRRLGLFKK ASELCILTGA EIVIIVQSLK  60
RRRPFAFGHP SVDTIIDSYV NEKLSSNGAD QLNNVQQNNQ YYSHICRELE EEKKKKEVIE  120
ETKMLNDGRF WWDKPTDDMG IEELEEFMTA LGELKKNVTM RADELSMTNG SSMHASSSNS  180
IILSLILSAW TPLTFRVISY NGLMIVNQLS NIITSTSFLV FMISHLMS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004231377.17e-89PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLK4B2N78e-89K4B2N7_SOLLC; Uncharacterized protein
STRINGSolyc01g106700.2.12e-88(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21342252
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.16e-28AGAMOUS-like 61